PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P05300_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 206aa    MW: 23588.7 Da    PI: 7.2727
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P05300_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.51.5e-2072126357
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                            k++++t+eq++ Le+ Fe ++++  e++ eLA+klg++ rqV vWFqNrRa++k+
  GSMUA_Achr5P05300_001  72 KKRRLTPEQVHLLERSFEAENKLEPERKGELARKLGMQPRQVAVWFQNRRARWKN 126
                            5678*************************************************95 PP

2HD-ZIP_I/II129.91e-4171160190
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl+ eqv+lLE+sFe+e+kLeperK elar+Lg+qprqvavWFqnrRAR+k+kqlE+d+++Lk++y++l +++++L +e+++Lr
  GSMUA_Achr5P05300_001  71 EKKRRLTPEQVHLLERSFEAENKLEPERKGELARKLGMQPRQVAVWFQNRRARWKNKQLEHDFDRLKSSYNTLLADHDSLLRENDRLR 158
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 ee 90 
                            ++
  GSMUA_Achr5P05300_001 159 SQ 160
                            87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.55667127IPR001356Homeobox domain
SMARTSM003892.3E-2070131IPR001356Homeobox domain
SuperFamilySSF466891.21E-1972138IPR009057Homeodomain-like
CDDcd000861.73E-1772128No hitNo description
PfamPF000468.6E-1872126IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-2273134IPR009057Homeodomain-like
PRINTSPR000313.7E-698107IPR000047Helix-turn-helix motif
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PRINTSPR000313.7E-6107123IPR000047Helix-turn-helix motif
PfamPF021839.2E-14127164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MDSGRLIFHS SLSHGHHGQQ MILLGGGGPV FGGGFLPVSA VEGASKRRPF FTSPDELLEE  60
EYYYYDEQLP EKKRRLTPEQ VHLLERSFEA ENKLEPERKG ELARKLGMQP RQVAVWFQNR  120
RARWKNKQLE HDFDRLKSSY NTLLADHDSL LRENDRLRSQ AYTLSLSPLD SKITPPSSSI  180
VFDEMVGVGA IGEWPPSCCY VRLHYG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119127RRARWKNKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009399661.15e-90PREDICTED: homeobox-leucine zipper protein HOX16-like
SwissprotQ022839e-59HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLM0SVV91e-152M0SVV9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P05300_0011e-152(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.17e-52homeobox 1